Lineage for d4c2va_ (4c2v A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2591318Species African clawed frog (Xenopus laevis) [TaxId:8355] [237113] (2 PDB entries)
  8. 2591319Domain d4c2va_: 4c2v A: [237116]
    Other proteins in same PDB: d4c2vb_
    automated match to d3kk8a_
    complexed with yja

Details for d4c2va_

PDB Entry: 4c2v (more details), 1.49 Å

PDB Description: Aurora B kinase in complex with the specific inhibitor Barasertib
PDB Compounds: (A:) aurora kinase b-a

SCOPe Domain Sequences for d4c2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2va_ d.144.1.0 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs
hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy
cherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkth
dekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllry
hppqrlplkgvmehpwvkansrrvlppvyqs

SCOPe Domain Coordinates for d4c2va_:

Click to download the PDB-style file with coordinates for d4c2va_.
(The format of our PDB-style files is described here.)

Timeline for d4c2va_: