Lineage for d1goha2 (1goh A:1-150)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383787Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
    automatically mapped to Pfam PF00754
  6. 2383788Protein Galactose oxidase, N-terminal domain [49787] (3 species)
  7. 2383789Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries)
    Uniprot Q01745 42-680
  8. 2383792Domain d1goha2: 1goh A:1-150 [23711]
    Other proteins in same PDB: d1goha1, d1goha3
    complexed with na

Details for d1goha2

PDB Entry: 1goh (more details), 2.2 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1goha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goha2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides [TaxId: 5132]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d1goha2:

Click to download the PDB-style file with coordinates for d1goha2.
(The format of our PDB-style files is described here.)

Timeline for d1goha2: