Lineage for d1goh_2 (1goh 1-150)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12057Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 12058Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 12059Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 12060Protein Galactose oxidase, N-terminal domain [49787] (1 species)
  7. 12061Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries)
  8. 12064Domain d1goh_2: 1goh 1-150 [23711]
    Other proteins in same PDB: d1goh_1, d1goh_3

Details for d1goh_2

PDB Entry: 1goh (more details), 2.2 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1goh_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goh_2 b.18.1.1 (1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOP Domain Coordinates for d1goh_2:

Click to download the PDB-style file with coordinates for d1goh_2.
(The format of our PDB-style files is described here.)

Timeline for d1goh_2: