SCOPe 2.07: Domain d3w94a_: 3w94 A:

Lineage for d3w94a_ (3w94 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Oryzias latipes [TaxId:8090] [237103] (1 PDB entry)

8. Domain d3w94a_: 3w94 A: [237105]
   automated match to d1ekbb_

Details for d3w94a_

PDB Entry: 3w94, 2 Å

PDB Description: structure of oryzias latipes enteropeptidase light chain

PDB Compounds: (A:) Enteropeptidase-1

SCOPe Domain Sequences for d3w94a_:

Sequence; same for both SEQRES and ATOM records:

>d3w94a_ b.47.1.2 (A:) automated matches {Oryzias latipes [TaxId: 8090]}
vvggvnaekgawpwmvslhwrgrhgcgasligrdwlltaahcvygknthlqywsavlglh
aqssmnsqevqirqvdriiinknynrrtkeadiammhlqqpvnftewvlpvclasedqhf
pagrrcfiagwgrdaeggslpdilqeaevplvdqdecqrllpeytftssmlcagypeggv
dscqgdsggplmcledarwtligvtsfgvgcgrperpgayarvsaftswiaetrr

Timeline for d3w94a_:

• d3w94a_ first appeared in SCOPe 2.03
  
• d3w94a_ appears in SCOPe 2.06
  
• d3w94a_ appears in the current release, SCOPe 2.08