Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Oryzias latipes [TaxId:8090] [237103] (1 PDB entry) |
Domain d3w94a_: 3w94 A: [237105] automated match to d1ekbb_ |
PDB Entry: 3w94 (more details), 2 Å
SCOPe Domain Sequences for d3w94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w94a_ b.47.1.2 (A:) automated matches {Oryzias latipes [TaxId: 8090]} vvggvnaekgawpwmvslhwrgrhgcgasligrdwlltaahcvygknthlqywsavlglh aqssmnsqevqirqvdriiinknynrrtkeadiammhlqqpvnftewvlpvclasedqhf pagrrcfiagwgrdaeggslpdilqeaevplvdqdecqrllpeytftssmlcagypeggv dscqgdsggplmcledarwtligvtsfgvgcgrperpgayarvsaftswiaetrr
Timeline for d3w94a_: