Lineage for d3w94a_ (3w94 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2797062Species Oryzias latipes [TaxId:8090] [237103] (1 PDB entry)
  8. 2797063Domain d3w94a_: 3w94 A: [237105]
    automated match to d1ekbb_

Details for d3w94a_

PDB Entry: 3w94 (more details), 2 Å

PDB Description: structure of oryzias latipes enteropeptidase light chain
PDB Compounds: (A:) Enteropeptidase-1

SCOPe Domain Sequences for d3w94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w94a_ b.47.1.2 (A:) automated matches {Oryzias latipes [TaxId: 8090]}
vvggvnaekgawpwmvslhwrgrhgcgasligrdwlltaahcvygknthlqywsavlglh
aqssmnsqevqirqvdriiinknynrrtkeadiammhlqqpvnftewvlpvclasedqhf
pagrrcfiagwgrdaeggslpdilqeaevplvdqdecqrllpeytftssmlcagypeggv
dscqgdsggplmcledarwtligvtsfgvgcgrperpgayarvsaftswiaetrr

SCOPe Domain Coordinates for d3w94a_:

Click to download the PDB-style file with coordinates for d3w94a_.
(The format of our PDB-style files is described here.)

Timeline for d3w94a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3w94b_