SCOPe 2.08: Domain d4nzul2: 4nzu L:108-211

Lineage for d4nzul2 (4nzu L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4nzul2: 4nzu L:108-211 [237102]
   Other proteins in same PDB: d4nzuh_, d4nzul1
   automated match to d1ce1l2
   complexed with act, gol

Details for d4nzul2

PDB Entry: 4nzu, 1.2 Å

PDB Description: Crystal structure of the primary monoclonal antibody 13PL Fab' from a multiple myeloma patient

PDB Compounds: (L:) 13PL heavy chain

SCOPe Domain Sequences for d4nzul2:

Sequence; same for both SEQRES and ATOM records:

>d4nzul2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4nzul2:

• d4nzul2 first appeared in SCOPe 2.03
  
• d4nzul2 appears in SCOPe 2.07