![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) ![]() |
![]() | Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) |
![]() | Protein Galactose oxidase, N-terminal domain [49787] (2 species) |
![]() | Species Dactylium dendroides [TaxId:5132] [49788] (4 PDB entries) |
![]() | Domain d1gog_2: 1gog 1-150 [23710] Other proteins in same PDB: d1gog_1, d1gog_3 complexed with cu, na |
PDB Entry: 1gog (more details), 1.9 Å
SCOP Domain Sequences for d1gog_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gog_2 b.18.1.1 (1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides} asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp aryvrlvaiteangqpwtsiaeinvfqass
Timeline for d1gog_2: