SCOP 1.57: Domain d1gog_2: 1gog 1-150

Lineage for d1gog_2 (1gog 1-150)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families)

5. Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)

6. Protein Galactose oxidase, N-terminal domain [49787] (1 species)

7. Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries)

8. Domain d1gog_2: 1gog 1-150 [23710]
   Other proteins in same PDB: d1gog_1, d1gog_3

Details for d1gog_2

PDB Entry: 1gog, 1.9 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

SCOP Domain Sequences for d1gog_2:

Sequence; same for both SEQRES and ATOM records:

>d1gog_2 b.18.1.1 (1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

Timeline for d1gog_2:

• d1gog_2 first appeared (with stable ids) in SCOP 1.55
  
• d1gog_2 appears in SCOP 1.59
  
• d1gog_2 appears in the current release, SCOPe 2.08, called d1goga2