![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein Galactose oxidase, N-terminal domain [49787] (3 species) |
![]() | Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries) Uniprot Q01745 42-680 |
![]() | Domain d1goga2: 1gog A:1-150 [23710] Other proteins in same PDB: d1goga1, d1goga3 complexed with cu, na |
PDB Entry: 1gog (more details), 1.9 Å
SCOPe Domain Sequences for d1goga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goga2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides [TaxId: 5132]} asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp aryvrlvaiteangqpwtsiaeinvfqass
Timeline for d1goga2: