Lineage for d1goga2 (1gog A:1-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774102Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
    automatically mapped to Pfam PF00754
  6. 2774103Protein Galactose oxidase, N-terminal domain [49787] (3 species)
  7. 2774104Species Dactylium dendroides [TaxId:5132] [49788] (3 PDB entries)
    Uniprot Q01745 42-680
  8. 2774106Domain d1goga2: 1gog A:1-150 [23710]
    Other proteins in same PDB: d1goga1, d1goga3
    complexed with cu, na

Details for d1goga2

PDB Entry: 1gog (more details), 1.9 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1goga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goga2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides [TaxId: 5132]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d1goga2:

Click to download the PDB-style file with coordinates for d1goga2.
(The format of our PDB-style files is described here.)

Timeline for d1goga2: