SCOPe 2.07: Domain d3wnxa_: 3wnx A:

Lineage for d3wnxa_ (3wnx A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
   mammalian protein related to legume lectins
   automatically mapped to Pfam PF03388

6. Protein automated matches [190462] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries)

8. Domain d3wnxa_: 3wnx A: [237099]
   automated match to d3whua_
   complexed with ca

Details for d3wnxa_

PDB Entry: 3wnx, 2.75 Å

PDB Description: crystal structure of ergic-53/mcfd2, calcium/man3-bound form

PDB Compounds: (A:) Protein ERGIC-53

SCOPe Domain Sequences for d3wnxa_:

Sequence; same for both SEQRES and ATOM records:

>d3wnxa_ b.29.1.13 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaaf
enwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkkn
npaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngft
pdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfql

Timeline for d3wnxa_:

• d3wnxa_ first appeared in SCOPe 2.03
  
• d3wnxa_ appears in SCOPe 2.06
  
• d3wnxa_ appears in the current release, SCOPe 2.08