Lineage for d4oe5b_ (4oe5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141255Species Human (Homo sapiens) [TaxId:9606] [225691] (17 PDB entries)
  8. 2141274Domain d4oe5b_: 4oe5 B: [237096]
    automated match to d3qanc_
    complexed with 1pe, mg

Details for d4oe5b_

PDB Entry: 4oe5 (more details), 1.95 Å

PDB Description: structure of human aldh4a1 crystallized in space group p21
PDB Compounds: (B:) Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4oe5b_:

Sequence, based on SEQRES records: (download)

>d4oe5b_ c.82.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
nfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqviketh

Sequence, based on observed residues (ATOM records): (download)

>d4oe5b_ c.82.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
vhrsadvesvvsgtlrsafeyggqkcsacsrlyvphslwpqikgrlleehsrikvgdpae
dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
nfyindkstgsigarasgtndkpggphyilrwtspqviketh

SCOPe Domain Coordinates for d4oe5b_:

Click to download the PDB-style file with coordinates for d4oe5b_.
(The format of our PDB-style files is described here.)

Timeline for d4oe5b_: