| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.0: automated matches [194891] (1 protein) not a true family |
| Protein automated matches [194892] (2 species) not a true protein |
| Species Micrurus tener [TaxId:1114302] [237091] (3 PDB entries) |
| Domain d4ntxc_: 4ntx C: [237092] Other proteins in same PDB: d4ntxb_ automated match to d1a3da_ complexed with amr, cl, na, nag, p6g |
PDB Entry: 4ntx (more details), 2.27 Å
SCOPe Domain Sequences for d4ntxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ntxc_ a.133.1.0 (C:) automated matches {Micrurus tener [TaxId: 1114302]}
nlnqfrlmikctndrvwadfvdygcycvardsntpvddldrccqaqkqcydeavkvhgck
plvmfysfecrylasdldcsgnntkcrnfvcncdrtatlciltatynrnnhkidpsrc
Timeline for d4ntxc_: