SCOPe 2.08: Domain d4ncc12: 4ncc 1:107-210

Lineage for d4ncc12 (4ncc 1:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4ncc12: 4ncc 1:107-210 [237081]
   Other proteins in same PDB: d4ncc11, d4ncc2_, d4ncch_, d4nccl1
   automated match to d1l7tl2

Details for d4ncc12

PDB Entry: 4ncc, 2.49 Å

PDB Description: Neutralizing antibody to murine norovirus

PDB Compounds: (1:) Fab fragment light

SCOPe Domain Sequences for d4ncc12:

Sequence; same for both SEQRES and ATOM records:

>d4ncc12 b.1.1.2 (1:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4ncc12:

• d4ncc12 first appeared in SCOPe 2.03
  
• d4ncc12 appears in SCOPe 2.07