SCOP 1.75: Domain d1qoub_: 1qou B:

Lineage for d1qoub_ (1qou B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (2 families)

5. Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (3 proteins)

6. Protein Centroradialis protein Cen [49782] (1 species)

7. Species Garden snapdragon (Antirrhinum majus) [TaxId:4151] [49783] (1 PDB entry)

8. Domain d1qoub_: 1qou B: [23708]

Details for d1qoub_

PDB Entry: 1qou, 1.9 Å

PDB Description: cen (centroradialis) protein from antirrhinum

PDB Compounds: (B:) cen

SCOP Domain Sequences for d1qoub_:

Sequence, based on SEQRES records:

>d1qoub_ b.17.1.1 (B:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}
vssdplvigrvigdvvdhftstvkmsviynsnnsikhvynghelfpsavtstprvevhgg
dmrsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihr
fvfllfkqkkrgqamlsppvvcrdgfntrkftqenelglpvaavffncqre

Sequence, based on observed residues (ATOM records):

>d1qoub_ b.17.1.1 (B:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}
vssdplvigrvigdvvdhftstvkmsviynssikhvynghelfpsavtstprvevhggdm
rsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihrfv
fllfkqkkrvvcrdgfntrkftqenelglpvaavffncqre

Timeline for d1qoub_:

• d1qoub_ first appeared (with stable ids) in SCOP 1.55
  
• d1qoub_ appears in SCOP 1.73
  
• d1qoub_ appears in SCOPe 2.01
  
• d1qoub_ appears in the current release, SCOPe 2.08