Lineage for d1qoub_ (1qou B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12040Fold b.17: Phosphatidylethanolamine binding protein [49776] (1 superfamily)
  4. 12041Superfamily b.17.1: Phosphatidylethanolamine binding protein [49777] (1 family) (S)
  5. 12042Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (2 proteins)
  6. 12043Protein Centroradialis protein Cen [49782] (1 species)
  7. 12044Species Garden snapdragon (Antirrhinum majus) [TaxId:4151] [49783] (1 PDB entry)
  8. 12046Domain d1qoub_: 1qou B: [23708]

Details for d1qoub_

PDB Entry: 1qou (more details), 1.9 Å

PDB Description: cen (centroradialis) protein from antirrhinum

SCOP Domain Sequences for d1qoub_:

Sequence, based on SEQRES records: (download)

>d1qoub_ b.17.1.1 (B:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus)}
vssdplvigrvigdvvdhftstvkmsviynsnnsikhvynghelfpsavtstprvevhgg
dmrsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihr
fvfllfkqkkrgqamlsppvvcrdgfntrkftqenelglpvaavffncqre

Sequence, based on observed residues (ATOM records): (download)

>d1qoub_ b.17.1.1 (B:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus)}
vssdplvigrvigdvvdhftstvkmsviynssikhvynghelfpsavtstprvevhggdm
rsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihrfv
fllfkqkkrvvcrdgfntrkftqenelglpvaavffncqre

SCOP Domain Coordinates for d1qoub_:

Click to download the PDB-style file with coordinates for d1qoub_.
(The format of our PDB-style files is described here.)

Timeline for d1qoub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qoua_