Lineage for d1qoub_ (1qou B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774039Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2774043Protein Centroradialis protein Cen [49782] (1 species)
  7. 2774044Species Garden snapdragon (Antirrhinum majus) [TaxId:4151] [49783] (1 PDB entry)
  8. 2774046Domain d1qoub_: 1qou B: [23708]

Details for d1qoub_

PDB Entry: 1qou (more details), 1.9 Å

PDB Description: cen (centroradialis) protein from antirrhinum
PDB Compounds: (B:) cen

SCOPe Domain Sequences for d1qoub_:

Sequence, based on SEQRES records: (download)

>d1qoub_ b.17.1.1 (B:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}
vssdplvigrvigdvvdhftstvkmsviynsnnsikhvynghelfpsavtstprvevhgg
dmrsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihr
fvfllfkqkkrgqamlsppvvcrdgfntrkftqenelglpvaavffncqre

Sequence, based on observed residues (ATOM records): (download)

>d1qoub_ b.17.1.1 (B:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]}
vssdplvigrvigdvvdhftstvkmsviynssikhvynghelfpsavtstprvevhggdm
rsfftlimtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihrfv
fllfkqkkrvvcrdgfntrkftqenelglpvaavffncqre

SCOPe Domain Coordinates for d1qoub_:

Click to download the PDB-style file with coordinates for d1qoub_.
(The format of our PDB-style files is described here.)

Timeline for d1qoub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qoua_