Lineage for d4nccl1 (4ncc L:1-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520962Domain d4nccl1: 4ncc L:1-106 [237078]
    Other proteins in same PDB: d4ncc12, d4nccl2
    automated match to d1l7tl1

Details for d4nccl1

PDB Entry: 4ncc (more details), 2.49 Å

PDB Description: Neutralizing antibody to murine norovirus
PDB Compounds: (L:) Fab fragment light

SCOPe Domain Sequences for d4nccl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nccl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypftfgggtkleik

SCOPe Domain Coordinates for d4nccl1:

Click to download the PDB-style file with coordinates for d4nccl1.
(The format of our PDB-style files is described here.)

Timeline for d4nccl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nccl2