SCOPe 2.03: Domain d4nccl1: 4ncc L:1-106

Lineage for d4nccl1 (4ncc L:1-106)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [227304] (35 PDB entries)

8. Domain d4nccl1: 4ncc L:1-106 [237078]
   Other proteins in same PDB: d4ncc12, d4nccl2
   automated match to d1l7tl1

Details for d4nccl1

PDB Entry: 4ncc, 2.49 Å

PDB Description: Neutralizing antibody to murine norovirus

PDB Compounds: (L:) Fab fragment light

SCOPe Domain Sequences for d4nccl1:

Sequence; same for both SEQRES and ATOM records:

>d4nccl1 b.1.1.0 (L:1-106) automated matches {Mus musculus [TaxId: 10090]}
qivltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypftfgggtkleik

Timeline for d4nccl1:

• d4nccl1 is new in SCOPe 2.03-stable
  
• d4nccl1 appears in SCOPe 2.04
  
• d4nccl1 appears in the current release, SCOPe 2.08