Lineage for d4nnwm_ (4nnw M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993748Domain d4nnwm_: 4nnw M: [237077]
    Other proteins in same PDB: d4nnwa_, d4nnwc2, d4nnwe_, d4nnwf_, d4nnwi_, d4nnwj_, d4nnwk_, d4nnwl_, d4nnwn_, d4nnwo_, d4nnwq2, d4nnws_, d4nnwt_, d4nnww_, d4nnwx_, d4nnwy_, d4nnwz_
    automated match to d4nnnm_
    complexed with 2mk, mg

Details for d4nnwm_

PDB Entry: 4nnw (more details), 2.6 Å

PDB Description: yCP in complex with Z-Leu-Leu-Leu-ketoaldehyde
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4nnwm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnwm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d4nnwm_:

Click to download the PDB-style file with coordinates for d4nnwm_.
(The format of our PDB-style files is described here.)

Timeline for d4nnwm_: