Lineage for d4niwa_ (4niw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2796835Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries)
  8. 2796849Domain d4niwa_: 4niw A: [237076]
    automated match to d4i8ha_
    complexed with ca, gol

Details for d4niwa_

PDB Entry: 4niw (more details), 1.31 Å

PDB Description: Crystal structure of trypsiligase (K60E/N143H/Y151H/D189K trypsin) orthorhombic form
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d4niwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4niwa_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyesgiqvrlgedninvvegne
qfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisgwg
htkssgtshpdvlkclkapilsdsscksaypgqitsnmfcagyleggkkscqgdsggpvv
csgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d4niwa_:

Click to download the PDB-style file with coordinates for d4niwa_.
(The format of our PDB-style files is described here.)

Timeline for d4niwa_: