| Class b: All beta proteins [48724] (180 folds) |
| Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() automatically mapped to Pfam PF03974 |
| Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
| Protein automated matches [191287] (2 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [237072] (1 PDB entry) |
| Domain d4niye_: 4niy E: [237073] Other proteins in same PDB: d4niya_, d4niyb_, d4niyc_, d4niyd_ automated match to d1ecya_ complexed with ca, zn |
PDB Entry: 4niy (more details), 2.84 Å
SCOPe Domain Sequences for d4niye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4niye_ b.16.1.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvsspvstyrhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv
kyrvwkaeekidnavvr
Timeline for d4niye_: