SCOPe 2.08: Domain d4n1gb_: 4n1g B:

Lineage for d4n1gb_ (4n1g B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Obelia longissima [TaxId:32570] [237068] (4 PDB entries)

8. Domain d4n1gb_: 4n1g B: [237071]
   automated match to d1uhka_
   complexed with ca, cei; mutant

Details for d4n1gb_

PDB Entry: 4n1g, 1.5 Å

PDB Description: Crystal Structure of Ca(2+)- discharged F88Y obelin mutant from Obelia longissima at 1.50 Angstrom resolution

PDB Compounds: (B:) obelin

SCOPe Domain Sequences for d4n1gb_:

Sequence; same for both SEQRES and ATOM records:

>d4n1gb_ a.39.1.5 (B:) automated matches {Obelia longissima [TaxId: 32570]}
askyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
krhqvcveaffrgcgmeygkeiafpqyldgwkqlatselkkwarneptlirewgdavfdi
fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
ldpeadglygngvp

Timeline for d4n1gb_:

• d4n1gb_ first appeared in SCOPe 2.03
  
• d4n1gb_ appears in SCOPe 2.07