Lineage for d1qoua_ (1qou A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225902Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 225903Superfamily b.17.1: PEBP-like [49777] (2 families) (S)
  5. 225904Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (2 proteins)
  6. 225905Protein Centroradialis protein Cen [49782] (1 species)
  7. 225906Species Garden snapdragon (Antirrhinum majus) [TaxId:4151] [49783] (1 PDB entry)
  8. 225907Domain d1qoua_: 1qou A: [23707]

Details for d1qoua_

PDB Entry: 1qou (more details), 1.9 Å

PDB Description: cen (centroradialis) protein from antirrhinum

SCOP Domain Sequences for d1qoua_:

Sequence, based on SEQRES records: (download)

>d1qoua_ b.17.1.1 (A:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus)}
grvigdvvdhftstvkmsviynsnnsikhvynghelfpsavtstprvevhggdmrsfftl
imtdpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihrfvfllfkq
kkrgqamlsppvvcrdgfntrkftqenelglpvaavffncqret

Sequence, based on observed residues (ATOM records): (download)

>d1qoua_ b.17.1.1 (A:) Centroradialis protein Cen {Garden snapdragon (Antirrhinum majus)}
grvigdvvdhftstvkmsviynsikhvynghelfpsavtstprvevhggdmrsfftlimt
dpdvpgpsdpylrehlhwivtdipgttdssfgkevvsyemprpnigihrfvfllfkqkkr
gvvcrdgfntrkftqenelglpvaavffncqret

SCOP Domain Coordinates for d1qoua_:

Click to download the PDB-style file with coordinates for d1qoua_.
(The format of our PDB-style files is described here.)

Timeline for d1qoua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qoub_