| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein automated matches [190064] (15 species) not a true protein |
| Species Obelia longissima [TaxId:32570] [237068] (3 PDB entries) |
| Domain d4n1ga_: 4n1g A: [237069] automated match to d1uhka_ complexed with ca, cei; mutant |
PDB Entry: 4n1g (more details), 1.5 Å
SCOPe Domain Sequences for d4n1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n1ga_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]}
askyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
krhqvcveaffrgcgmeygkeiafpqyldgwkqlatselkkwarneptlirewgdavfdi
fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
ldpeadglygngvp
Timeline for d4n1ga_: