Lineage for d4me6a2 (4me6 A:140-365)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217811Species Xanthomonas oryzae [TaxId:342109] [225705] (4 PDB entries)
  8. 2217814Domain d4me6a2: 4me6 A:140-365 [237067]
    Other proteins in same PDB: d4me6a1
    automated match to d3e5na2
    complexed with adp, mg

Details for d4me6a2

PDB Entry: 4me6 (more details), 2.1 Å

PDB Description: Crystal structure of D-alanine-D-alanine ligase A from Xanthomonas oryzae pathovar oryzae with ADP
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4me6a2:

Sequence, based on SEQRES records: (download)

>d4me6a2 d.142.1.0 (A:140-365) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqllrsave

Sequence, based on observed residues (ATOM records): (download)

>d4me6a2 d.142.1.0 (A:140-365) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtahadvdtliaqlglplfvkpanqvgvsqvrtada
faaalalalaydhkvlveaavagreiecavlgnavphasvcgevveivipadidaqtqqr
iqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasgldyrg
litrlielalerhtddqllrsave

SCOPe Domain Coordinates for d4me6a2:

Click to download the PDB-style file with coordinates for d4me6a2.
(The format of our PDB-style files is described here.)

Timeline for d4me6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4me6a1