SCOPe 2.03: Domain d4me6a2: 4me6 A:140-365

Lineage for d4me6a2 (4me6 A:140-365)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (18 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:342109] [225705] (4 PDB entries)

8. Domain d4me6a2: 4me6 A:140-365 [237067]
   Other proteins in same PDB: d4me6a1
   automated match to d3e5na2
   complexed with adp, mg

Details for d4me6a2

PDB Entry: 4me6, 2.1 Å

PDB Description: Crystal structure of D-alanine-D-alanine ligase A from Xanthomonas oryzae pathovar oryzae with ADP

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4me6a2:

Sequence, based on SEQRES records:

>d4me6a2 d.142.1.0 (A:140-365) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqllrsave

Sequence, based on observed residues (ATOM records):

>d4me6a2 d.142.1.0 (A:140-365) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtahadvdtliaqlglplfvkpanqvgvsqvrtada
faaalalalaydhkvlveaavagreiecavlgnavphasvcgevveivipadidaqtqqr
iqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasgldyrg
litrlielalerhtddqllrsave

Timeline for d4me6a2:

• d4me6a2 is new in SCOPe 2.03-stable
  
• d4me6a2 appears in SCOPe 2.04
  
• d4me6a2 appears in the current release, SCOPe 2.08