Lineage for d4m99c_ (4m99 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814325Species Neisseria gonorrhoeae [TaxId:242231] [235544] (2 PDB entries)
  8. 2814329Domain d4m99c_: 4m99 C: [237065]
    automated match to d4m99a_
    complexed with aco, na

Details for d4m99c_

PDB Entry: 4m99 (more details), 2.6 Å

PDB Description: Acetyltransferase domain of PglB from Neisseria gonorrhoeae FA1090 in complex with acetyl coenzyme A
PDB Compounds: (C:) Pilin glycosylation protein

SCOPe Domain Sequences for d4m99c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m99c_ b.81.1.0 (C:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
gnrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllenslspe
qfditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqags
vlkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgsgv
tagagavivcdipdgmtvagnpakpl

SCOPe Domain Coordinates for d4m99c_:

Click to download the PDB-style file with coordinates for d4m99c_.
(The format of our PDB-style files is described here.)

Timeline for d4m99c_: