SCOPe 2.08: Domain d4ku1a2: 4ku1 A:342-443

Lineage for d4ku1a2 (4ku1 A:342-443)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4ku1a2: 4ku1 A:342-443 [237063]
   automated match to d1igtb4
   complexed with pg4

Details for d4ku1a2

PDB Entry: 4ku1, 1.9 Å

PDB Description: role of the hinge and c-gamma-2/c-gamma-3 interface in immunoglobin g1 fc domain motions: implications for fc engineering

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4ku1a2:

Sequence; same for both SEQRES and ATOM records:

>d4ku1a2 b.1.1.0 (A:342-443) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d4ku1a2:

• d4ku1a2 first appeared in SCOPe 2.03
  
• d4ku1a2 appears in SCOPe 2.07