Class b: All beta proteins [48724] (180 folds) |
Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.17.1: PEBP-like [49777] (3 families) |
Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [49781] (2 PDB entries) |
Domain d1b7ab_: 1b7a B: [23706] complexed with ope |
PDB Entry: 1b7a (more details), 2.25 Å
SCOPe Domain Sequences for d1b7ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7ab_ b.17.1.1 (B:) Phosphatidylethanolamine binding protein, PEBP {Cow (Bos taurus) [TaxId: 9913]} pvdlskwsgplslqevderpqhplqvkyggaevdelgkvltptqvknrptsitwdgldpg klytlvltdpdapsrkdpkyrewhhflvvnmkgnnissgtvlsdyvgsgppkgtglhryv wlvyeqegplkcdepilsnrsgdhrgkfkvasfrkkyelgapvagtcyqaewddyvpkly eqlsgk
Timeline for d1b7ab_: