Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species) |
Species Staphylococcus aureus [TaxId:1280] [188976] (33 PDB entries) |
Domain d4laex_: 4lae X: [237057] automated match to d3sqyx_ complexed with 1vm, nap |
PDB Entry: 4lae (more details), 1.69 Å
SCOPe Domain Sequences for d4laex_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4laex_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]} tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd tffppytfedwevassvegkldekntiphtflhlirk
Timeline for d4laex_: