Lineage for d4lagx_ (4lag X:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2153746Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 2153889Species Staphylococcus aureus [TaxId:1280] [188976] (25 PDB entries)
  8. 2153898Domain d4lagx_: 4lag X: [237056]
    automated match to d3sqyx_
    complexed with 1vn, nap

Details for d4lagx_

PDB Entry: 4lag (more details), 1.7 Å

PDB Description: Structure-Based Design of New Dihydrofolate Reductase Antibacterial Agents: 7-(Benzimidazol-1-yl)-2,4-diaminoquinazolines
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d4lagx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lagx_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d4lagx_:

Click to download the PDB-style file with coordinates for d4lagx_.
(The format of our PDB-style files is described here.)

Timeline for d4lagx_: