Lineage for d1b7aa_ (1b7a A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774039Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2774047Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species)
  7. 2774048Species Cow (Bos taurus) [TaxId:9913] [49781] (2 PDB entries)
  8. 2774050Domain d1b7aa_: 1b7a A: [23705]
    complexed with ope

Details for d1b7aa_

PDB Entry: 1b7a (more details), 2.25 Å

PDB Description: structure of the phosphatidylethanolamine-binding protein from bovine brain
PDB Compounds: (A:) phosphatidylethanolamine-binding protein

SCOPe Domain Sequences for d1b7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7aa_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Cow (Bos taurus) [TaxId: 9913]}
pvdlskwsgplslqevderpqhplqvkyggaevdelgkvltptqvknrptsitwdgldpg
klytlvltdpdapsrkdpkyrewhhflvvnmkgnnissgtvlsdyvgsgppkgtglhryv
wlvyeqegplkcdepilsnrsgdhrgkfkvasfrkkyelgapvagtcyqaewddyvpkly
eqlsgk

SCOPe Domain Coordinates for d1b7aa_:

Click to download the PDB-style file with coordinates for d1b7aa_.
(The format of our PDB-style files is described here.)

Timeline for d1b7aa_: