Lineage for d4l7na1 (4l7n A:178-321)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712230Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2712231Protein automated matches [226964] (2 species)
    not a true protein
  7. 2712235Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries)
  8. 2712251Domain d4l7na1: 4l7n A:178-321 [237041]
    Other proteins in same PDB: d4l7na2, d4l7na3
    automated match to d3c49a1
    complexed with 1vb

Details for d4l7na1

PDB Entry: 4l7n (more details), 1.8 Å

PDB Description: Human artd3 (parp3) - catalytic domain in complex with inhibitor STO1542
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d4l7na1:

Sequence, based on SEQRES records: (download)

>d4l7na1 a.41.1.0 (A:178-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
ealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqa
lqavseqektveevphpldrdyql

Sequence, based on observed residues (ATOM records): (download)

>d4l7na1 a.41.1.0 (A:178-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
ealkdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqalqa
vseqektveevphpldrdyql

SCOPe Domain Coordinates for d4l7na1:

Click to download the PDB-style file with coordinates for d4l7na1.
(The format of our PDB-style files is described here.)

Timeline for d4l7na1: