Lineage for d4l7da_ (4l7d A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802967Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 1802968Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 1802977Protein automated matches [190126] (2 species)
    not a true protein
  7. 1802978Species Human (Homo sapiens) [TaxId:9606] [193097] (11 PDB entries)
  8. 1802988Domain d4l7da_: 4l7d A: [237038]
    automated match to d4in4c_
    complexed with 1vx, act

Details for d4l7da_

PDB Entry: 4l7d (more details), 2.25 Å

PDB Description: Structure of keap1 kelch domain with (1S,2R)-2-{[(1S)-5-methyl-1-[(1-oxo-1,3-dihydro-2H-isoindol-2-yl)methyl]-3,4-dihydroisoquinolin-2(1H)-yl]carbonyl}cyclohexanecarboxylic acid
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4l7da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l7da_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rliytaggyfrqslsyleaynpsdgtwldladlqvprsglagcvvggllyavggrnnspd
gntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsveryep
erdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamnt
irsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqgr
iyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavtle

SCOPe Domain Coordinates for d4l7da_:

Click to download the PDB-style file with coordinates for d4l7da_.
(The format of our PDB-style files is described here.)

Timeline for d4l7da_: