Lineage for d4l7pa1 (4l7p A:178-321)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321349Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2321350Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2321375Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2321376Protein automated matches [226964] (1 species)
    not a true protein
  7. 2321377Species Human (Homo sapiens) [TaxId:9606] [225405] (47 PDB entries)
  8. 2321400Domain d4l7pa1: 4l7p A:178-321 [237035]
    Other proteins in same PDB: d4l7pa2, d4l7pa3
    automated match to d3c49a1
    complexed with m95

Details for d4l7pa1

PDB Entry: 4l7p (more details), 2.3 Å

PDB Description: Human artd3 (parp3) - catalytic domain in complex with inhibitor ME0395
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d4l7pa1:

Sequence, based on SEQRES records: (download)

>d4l7pa1 a.41.1.0 (A:178-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
ealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqa
lqavseqektveevphpldrdyql

Sequence, based on observed residues (ATOM records): (download)

>d4l7pa1 a.41.1.0 (A:178-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
ealkqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqalqavse
qektveevphpldrdyql

SCOPe Domain Coordinates for d4l7pa1:

Click to download the PDB-style file with coordinates for d4l7pa1.
(The format of our PDB-style files is described here.)

Timeline for d4l7pa1: