![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (39 species) not a true protein |
![]() | Species Xanthomonas oryzae [TaxId:342109] [225705] (4 PDB entries) |
![]() | Domain d4l1ka2: 4l1k A:140-360 [237033] Other proteins in same PDB: d4l1ka1 automated match to d3rfca2 complexed with anp, mg |
PDB Entry: 4l1k (more details), 2.3 Å
SCOPe Domain Sequences for d4l1ka2:
Sequence, based on SEQRES records: (download)
>d4l1ka2 d.142.1.0 (A:140-360) automated matches {Xanthomonas oryzae [TaxId: 342109]} dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl pgftrisvypklwqasgldyrglitrlielalerhtddqll
>d4l1ka2 d.142.1.0 (A:140-360) automated matches {Xanthomonas oryzae [TaxId: 342109]} dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvveivipadida qtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasg ldyrglitrlielalerhtddqll
Timeline for d4l1ka2: