SCOPe 2.08: Domain d4l1ka2: 4l1k A:140-360

Lineage for d4l1ka2 (4l1k A:140-360)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:342109] [225705] (4 PDB entries)

8. Domain d4l1ka2: 4l1k A:140-360 [237033]
   Other proteins in same PDB: d4l1ka1
   automated match to d3rfca2
   complexed with anp, mg

Details for d4l1ka2

PDB Entry: 4l1k, 2.3 Å

PDB Description: crystal structure of d-alanine-d-alnine ligase from xanthomonas oryzae pv. oryzae with amppnp

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4l1ka2:

Sequence, based on SEQRES records:

>d4l1ka2 d.142.1.0 (A:140-360) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqll

Sequence, based on observed residues (ATOM records):

>d4l1ka2 d.142.1.0 (A:140-360) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvveivipadida
qtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasg
ldyrglitrlielalerhtddqll

Timeline for d4l1ka2:

• d4l1ka2 first appeared in SCOPe 2.03
  
• d4l1ka2 appears in SCOPe 2.07