Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (35 species) not a true protein |
Species Xanthomonas oryzae [TaxId:342109] [225704] (4 PDB entries) |
Domain d4l1ka1: 4l1k A:2-139 [237032] Other proteins in same PDB: d4l1ka2 automated match to d3rfca1 complexed with anp, mg |
PDB Entry: 4l1k (more details), 2.3 Å
SCOPe Domain Sequences for d4l1ka1:
Sequence, based on SEQRES records: (download)
>d4l1ka1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]} rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha ddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvfpivhgtlgedgslqgllr manlpfvgsgvlgsavam
>d4l1ka1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]} rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha ddparialhrsgrgvallpgaqqqqlrpiqqalaqidvvfpivhgtlgedgslqgllrma nlpfvgsgvlgsavam
Timeline for d4l1ka1: