SCOPe 2.06: Domain d4l1ka1: 4l1k A:2-139

Lineage for d4l1ka1 (4l1k A:2-139)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (35 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:342109] [225704] (4 PDB entries)

8. Domain d4l1ka1: 4l1k A:2-139 [237032]
   Other proteins in same PDB: d4l1ka2
   automated match to d3rfca1
   complexed with anp, mg

Details for d4l1ka1

PDB Entry: 4l1k, 2.3 Å

PDB Description: crystal structure of d-alanine-d-alnine ligase from xanthomonas oryzae pv. oryzae with amppnp

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4l1ka1:

Sequence, based on SEQRES records:

>d4l1ka1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]}
rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
ddparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvfpivhgtlgedgslqgllr
manlpfvgsgvlgsavam

Sequence, based on observed residues (ATOM records):

>d4l1ka1 c.30.1.0 (A:2-139) automated matches {Xanthomonas oryzae [TaxId: 342109]}
rkirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllha
ddparialhrsgrgvallpgaqqqqlrpiqqalaqidvvfpivhgtlgedgslqgllrma
nlpfvgsgvlgsavam

Timeline for d4l1ka1:

• d4l1ka1 first appeared in SCOPe 2.03
  
• d4l1ka1 appears in SCOPe 2.05
  
• d4l1ka1 appears in SCOPe 2.07
  
• d4l1ka1 appears in the current release, SCOPe 2.08