SCOPe 2.05: Domain d4j5ba_: 4j5b A:

Lineage for d4j5ba_ (4j5b A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141512] (30 PDB entries)
   Uniprot P30405 44-207

8. Domain d4j5ba_: 4j5b A: [237023]
   automated match to d3qyua_
   complexed with 6b4

Details for d4j5ba_

PDB Entry: 4j5b, 2.01 Å

PDB Description: human cyclophilin d complexed with an inhibitor

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase F, mitochondrial

SCOPe Domain Sequences for d4j5ba_:

Sequence; same for both SEQRES and ATOM records:

>d4j5ba_ b.62.1.1 (A:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

Timeline for d4j5ba_:

• d4j5ba_ first appeared in SCOPe 2.03
  
• d4j5ba_ appears in SCOPe 2.04
  
• d4j5ba_ appears in SCOPe 2.06
  
• d4j5ba_ appears in the current release, SCOPe 2.08