SCOPe 2.07: Domain d4j2ea1: 4j2e A:1-375

Lineage for d4j2ea1 (4j2e A:1-375)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Bacteriophage RB69 [TaxId:12353] [53127] (93 PDB entries)
   additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold

8. Domain d4j2ea1: 4j2e A:1-375 [237018]
   Other proteins in same PDB: d4j2ea2
   automated match to d1ih7a1
   protein/DNA complex; complexed with atp, ca

Details for d4j2ea1

PDB Entry: 4j2e, 2.02 Å

PDB Description: RB69 DNA Polymerase L415M Ternary Complex

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4j2ea1:

Sequence; same for both SEQRES and ATOM records:

>d4j2ea1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

Timeline for d4j2ea1:

• d4j2ea1 first appeared in SCOPe 2.03
  
• d4j2ea1 appears in SCOPe 2.06
  
• d4j2ea1 appears in the current release, SCOPe 2.08