Lineage for d4iccx_ (4icc X:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2092401Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2092402Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2092464Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2092465Species Human (Homo sapiens) [TaxId:9606] [51437] (135 PDB entries)
    Uniprot P15121
  8. 2092569Domain d4iccx_: 4icc X: [237013]
    automated match to d4gqga_
    complexed with 64i, nap

Details for d4iccx_

PDB Entry: 4icc (more details), 1.75 Å

PDB Description: crystal structure of human akr1b10 complexed with nadp+ and jf0064
PDB Compounds: (X:) Aldo-keto reductase family 1 member B10

SCOPe Domain Sequences for d4iccx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iccx_ c.1.7.1 (X:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
matfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiq
ekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgd
dlfprddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykp
vtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaak
hkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracn
llqsshledypfnaey

SCOPe Domain Coordinates for d4iccx_:

Click to download the PDB-style file with coordinates for d4iccx_.
(The format of our PDB-style files is described here.)

Timeline for d4iccx_: