Lineage for d1behb_ (1beh B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776925Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1776926Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 1776927Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 1776935Protein Phosphatidylethanolamine binding protein, PEBP [49779] (3 species)
  7. 1776940Species Human (Homo sapiens) [TaxId:9606] [49780] (3 PDB entries)
  8. 1776943Domain d1behb_: 1beh B: [23701]
    complexed with cac

Details for d1behb_

PDB Entry: 1beh (more details), 1.75 Å

PDB Description: human phosphatidylethanolamine binding protein in complex with cacodylate
PDB Compounds: (B:) phosphatidylethanolamine binding protein

SCOPe Domain Sequences for d1behb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1behb_ b.17.1.1 (B:) Phosphatidylethanolamine binding protein, PEBP {Human (Homo sapiens) [TaxId: 9606]}
dlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdgldsgkl
ytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhryvwl
vyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpklyeq
lsg

SCOPe Domain Coordinates for d1behb_:

Click to download the PDB-style file with coordinates for d1behb_.
(The format of our PDB-style files is described here.)

Timeline for d1behb_: