Lineage for d4grwe_ (4grw E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290342Species Llama glama [TaxId:9844] [236993] (1 PDB entry)
  8. 1290343Domain d4grwe_: 4grw E: [236996]
    automated match to d1vhpa_

Details for d4grwe_

PDB Entry: 4grw (more details), 2.55 Å

PDB Description: structure of a complex of human il-23 with 3 nanobodies (llama vhhs)
PDB Compounds: (E:) Nanobody 124C4

SCOPe Domain Sequences for d4grwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grwe_ b.1.1.1 (E:) automated matches {Llama glama [TaxId: 9844]}
evqlvesggglvqpggslrlscaasgftlddyaiawfrqapgkeregvsgidsgdgsayy
adsvkgrftissdnakntvylqmnslrpedtavyycarvrtgwglnapdyamdywgkgtl
vtvss

SCOPe Domain Coordinates for d4grwe_:

Click to download the PDB-style file with coordinates for d4grwe_.
(The format of our PDB-style files is described here.)

Timeline for d4grwe_: