| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Llama glama [TaxId:9844] [236993] (3 PDB entries) |
| Domain d4grwe_: 4grw E: [236996] automated match to d1vhpa_ |
PDB Entry: 4grw (more details), 2.55 Å
SCOPe Domain Sequences for d4grwe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4grwe_ b.1.1.1 (E:) automated matches {Llama glama [TaxId: 9844]}
evqlvesggglvqpggslrlscaasgftlddyaiawfrqapgkeregvsgidsgdgsayy
adsvkgrftissdnakntvylqmnslrpedtavyycarvrtgwglnapdyamdywgkgtl
vtvss
Timeline for d4grwe_: