Lineage for d4grwj_ (4grw J:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020193Species Llama glama [TaxId:9844] [236993] (1 PDB entry)
  8. 2020199Domain d4grwj_: 4grw J: [236995]
    automated match to d1ol0a_

Details for d4grwj_

PDB Entry: 4grw (more details), 2.55 Å

PDB Description: Structure of a complex of human IL-23 with 3 Nanobodies (Llama vHHs)
PDB Compounds: (J:) Nanobody 37D5

SCOPe Domain Sequences for d4grwj_:

Sequence, based on SEQRES records: (download)

>d4grwj_ b.1.1.1 (J:) automated matches {Llama glama [TaxId: 9844]}
qlvesggglvqpggslrlscaasgftldylaigwfrqapgkeregvscvsssgqytyyad
svkgrftisrdnaestvylqmnslkpedtavyycatdpecyrvrgyyngeydywgqgtqv
tvss

Sequence, based on observed residues (ATOM records): (download)

>d4grwj_ b.1.1.1 (J:) automated matches {Llama glama [TaxId: 9844]}
qlvesggglvqpggslrlscaasgftldylaigwfrqapgkeregvscvsssgqytyyad
svkgrftisrdnaestvylqmnslkpedtavyycatdpecyrvrgyyngdywgqgtqvtv
ss

SCOPe Domain Coordinates for d4grwj_:

Click to download the PDB-style file with coordinates for d4grwj_.
(The format of our PDB-style files is described here.)

Timeline for d4grwj_: