Lineage for d4grwf_ (4grw F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744165Species Llama glama [TaxId:9844] [236993] (3 PDB entries)
  8. 2744168Domain d4grwf_: 4grw F: [236994]
    automated match to d1ol0a_

Details for d4grwf_

PDB Entry: 4grw (more details), 2.55 Å

PDB Description: structure of a complex of human il-23 with 3 nanobodies (llama vhhs)
PDB Compounds: (F:) Nanobody 37D5

SCOPe Domain Sequences for d4grwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grwf_ b.1.1.1 (F:) automated matches {Llama glama [TaxId: 9844]}
vqlvesggglvqpggslrlscaasgftldylaigwfrqapgkeregvscvsssgqytyya
dsvkgrftisrdnaestvylqmnslkpedtavyycatdpecyrvrgyyngeydywgqgtq
vtvss

SCOPe Domain Coordinates for d4grwf_:

Click to download the PDB-style file with coordinates for d4grwf_.
(The format of our PDB-style files is described here.)

Timeline for d4grwf_: