| Class b: All beta proteins [48724] (178 folds) |
| Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() automatically mapped to Pfam PF03974 |
| Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
| Protein Ecotin, trypsin inhibitor [49774] (1 species) |
| Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
| Domain d1eczb_: 1ecz B: [23699] complexed with bog |
PDB Entry: 1ecz (more details), 2.68 Å
SCOPe Domain Sequences for d1eczb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eczb_ b.16.1.1 (B:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
dnvdvkyrvwkaeekidnavvr
Timeline for d1eczb_: