SCOP 1.57: Domain d1eczb_: 1ecz B:

Lineage for d1eczb_ (1ecz B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (12 PDB entries)

8. Domain d1eczb_: 1ecz B: [23699]

Details for d1eczb_

PDB Entry: 1ecz, 2.68 Å

PDB Description: protease inhibitor ecotin

SCOP Domain Sequences for d1eczb_:

Sequence; same for both SEQRES and ATOM records:

>d1eczb_ b.16.1.1 (B:) Ecotin, trypsin inhibitor {Escherichia coli}
aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
dnvdvkyrvwkaeekidnavvr

Timeline for d1eczb_:

• d1eczb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eczb_ appears in SCOP 1.59
  
• d1eczb_ appears in the current release, SCOPe 2.08