SCOPe 2.04: Domain d4cdua_: 4cdu A:

Lineage for d4cdua_ (4cdu A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (7 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [226325] (11 PDB entries)

8. Domain d4cdua_: 4cdu A: [236978]
   Other proteins in same PDB: d4cduc_
   automated match to d4cdwa_
   complexed with cl, na, ym2

Details for d4cdua_

PDB Entry: 4cdu, 2.8 Å

PDB Description: crystal structure of human enterovirus 71 in complex with the uncoating inhibitor gpp3

PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d4cdua_:

Sequence; same for both SEQRES and ATOM records:

>d4cdua_ b.121.4.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gdrvadviessigdsvsralthalpaptgqntqvsshrldtgkvpalqaaeigassnasd
esmietrcvlnshstaettldsffsraglvgeidlplkgttnpngyanwdiditgyaqmr
rkvelftymrfdaeftfvactptgevvpqllqymfvppgapkpdsreslawqtatnpsvf
vklsdppaqvsvpfmspasayqwfydgyptfgehkqekdleygacpnnmmgtfsvrtvgt
skskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgasrtaittl

Timeline for d4cdua_:

• d4cdua_ first appeared in SCOPe 2.03
  
• d4cdua_ appears in SCOPe 2.05
  
• d4cdua_ appears in the current release, SCOPe 2.08