| Class b: All beta proteins [48724] (180 folds) |
| Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
| Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
| Protein automated matches [190988] (51 species) not a true protein |
| Species Human enterovirus 71 [TaxId:39054] [226325] (11 PDB entries) |
| Domain d4cdua_: 4cdu A: [236978] Other proteins in same PDB: d4cduc_ automated match to d4cdwa_ complexed with cl, na, ym2 |
PDB Entry: 4cdu (more details), 2.8 Å
SCOPe Domain Sequences for d4cdua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cdua_ b.121.4.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gdrvadviessigdsvsralthalpaptgqntqvsshrldtgkvpalqaaeigassnasd
esmietrcvlnshstaettldsffsraglvgeidlplkgttnpngyanwdiditgyaqmr
rkvelftymrfdaeftfvactptgevvpqllqymfvppgapkpdsreslawqtatnpsvf
vklsdppaqvsvpfmspasayqwfydgyptfgehkqekdleygacpnnmmgtfsvrtvgt
skskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgasrtaittl
Timeline for d4cdua_: